Rapport de stage technicien








télécharger 210.08 Kb.
titreRapport de stage technicien
page8/8
date de publication07.01.2017
taille210.08 Kb.
typeRapport
b.21-bal.com > documents > Rapport
1   2   3   4   5   6   7   8

Tsukuba : SSB616 ; VSC608 ; VSC636 ; SSI385 ; SSL289

Homologues :
Arabidopsis thaliana : VAMP 722 ; VAMP 725 ; VAMP 721 

VAMP 712 ; VAMP 724 ; VAMP 714 ; VAMP 711 ; VAMP 713 ; VAMP 723 ; VAMP 726
Saccharomyces cerevisiae : SNC 2 ; SNC 1

NYV 1
Homo sapiens : VAMP 4

Séquence d’acides aminés : core : 66 aa  ; TM
MSNNPNNSGQPNKTQSILQEVDKVKDVMHNNIGLMLNNHDKASNLQDKTASMSNNARLFKKQTVTIRRQMWCRNMKLQLIIIAVVILVLAVILIPIIMKFV



  • VAMP 7A


Longueur : 216 acides aminés
Point isoélectrique : 9.20
Poids moléculaire : 24771.92
Clones :

Tsukuba : SSE763 ; SSH201 ; SSI250 ; SSM672 
Baylor : IIAFP1D10321 ; IIAFP1D58829 
Jena : JAX4a63e02
Homologues :
Arabidopsis thaliana : VAMP 714 ; VAMP 711 ; VAMP 713 ; VAMP 712

VAMP 722 ; VAMP 727 ; VAMP 721 ; VAMP 725 ; VAMP 723 ; VAMP 726 ; VAMP 724

SEC 22
Saccharomyces cerevisiae : SNC 1
NYV 1 ; SNC 2


Homo sapiens : SYBL 1 ; VAMP 7
Séquence d’acides aminés : core : 43 aa  ; TM ; intron
MSQTDILYACVSYKGVCLVEHKIANGNFIDLARRLITKIPPTSKKIYTSENHNFHYISENDLAFLCLCHEKLGVQIPSEFLSDIRQQFIRSYGQSFSQNSPTATYDPFIRVLEERMKYYSNPKSNKMNLVMDQVSEAKGALTDAIEKTIHRGEKIEIIVDKTERLQSESFVFKSNSVALKRKLWWQNKKLAIAIGLVVCILIAVITLALLKYFKVI
Séquence nucléique des introns :
R :gtnnnnnnnnnnnnnaaataaaaataaaaataaataaatctttaaataaattcaata ctaataatttaaacttaaatataaaacacaacatcaattctaaatgataatttataaataactatataaatacaataataacaataacaataacaataacaataacaataatacaactttttatcaactttttttatcaatag



E : gtaggttttttttttttttttttttttatatgttgtccacatcatcaaatattattgt tgtgtggggcgtttttttttttaaaaaattggaaaagatatttttttttaatttttttaaaaggttttccgacctgtggttacatcatcagacattaacaaattaattattttaattttccaaaaaatatag
CI : gtaagtttacctaaaaaaaaaaaaaaaaaaaaaattaaaattaaaatcaattactaa ttctcttttcttttatag

  • VAMP 7B


Longueur : 260 acides aminés
Point isoélectrique : 8.78
Poids moléculaire : 29561.18

Clones :

Tsukuba : SSE713
Iena : JC1a08f12 ; JC2b80g08 ; JC2e95e09 ; JC2e08e04

Homologues :
Arabidopsis thaliana : VAMP 714 ; VAMP 711 ; VAMP 713 ; VAMP 712 ; VAMP 722 ; VAMP 727 ; VAMP 721 ; VAMP 725 ; VAMP 723 ; VAMP 726 ; VAMP 724

SEC 22
Saccharomyces cerevisiae : SNC 1

NYV 1 ; SNC 2
Homo sapiens : SYBL 1 ; VAMP 7

Séquence d’acides aminés : core : 68 aa  ; TM ; intron
MPIIYSLVARGSSVLAEFTSTNGNFVTITRRILDLIPPNDTKMSYVYEKYIFHYLVSDTLTYLCMADEEFGRRIPFTFLDDVKNRFKSMYGDKGKTAIAYGMNSDFSRTLENLMDHYSNTTRVDTMSRTMAEIDEVKNILVSDIAPQLLKRGEKIEMLVERTDTLNQQSFKFKKQSKQLKCAMWWKNVKLMLVLGAIVLIIIFIIVMSYCDGFRSGSKCRSSPSSNSTPTPTPTETPTPTPTPTSTPTPSQLLETLLNQFD

c) YKT 6


  • YKT 6A


Longueur : 187 acides aminés
Point isoélectrique : 8.27
Poids moléculaire : 21129.54

Clones :

Tsukuba : SSK653
Sanger : sdic6A70c8

Homologues :
Arabidopsis thaliana : YKT 61

YKT62
Saccharomyces cerevisiae : YKT 6
Homo sapiens : YKT 6

Séquence d’acides aminés : core : 60 aa  ; intron
MKLVAMVLAKRKGDLLEIACDLSQFGFFEKGTVKEVIIAASKIFINKFDPNTRHSVPYEDYICFIDVRAEFGGVVFTDKEYPERVAARLLSEMMNGYVKKTQGIIGAPYPELQGIFKNSDPKANDKILEVQNQVNEVTSIMHKNIDVALGNTEKMETLLETSDDLSTRSKLFLKQAKKANRRCCIIQ

Séquence nucléique des introns :
T : gtatgtatcaattaaaaacataaattgaaattgaaatagaaatagaaatagatattaa acatttatttag
G : gtaactattttattatttatttattgtttattatttattatttattatttattgttta taatattaatattaattatgaaaaaaaaaaaaaaaaaag

  • YKT 6B


Longueur : 202 acides aminés
Point isoélectrique : 6.11
Poids moléculaire : 22771.05

Clones :

Tsukuba : SSE629 ; SSF114 
Sanger : sdic6A6d8
Baylor : IIABP1D3011 ; IIAFP1D19113 ; IIAAP1D3931 ; IIAFP1D56069 ; IIAFP1D60119 
Jena : JC1c36g10 ; JC1a214h03 ; JAX4a217b10

Homologues :
Arabidopsis thaliana : YKT 61

YKT62
Saccharomyces cerevisiae : YKT 6
Homo sapiens : YKT 6

Séquence d’acides aminés : core : 82 aa 
MKVYSIGLFKVVPGNKPVLLNIVYELSSFGFFQRGSVKEVSLFVSRETVGRTNVGERVSMEHTQTQKVCHTTVDSKGLGCSVLTDSEYPGRVAHTLIRICLEEFYKVHPESEWRGLQSDVELQTPALDQLLLKYQNPETADPMMNLQKNLDETITIVKKTVEQLGQRGEKLDDLAAKSDDLSFQSKAFMNNAERMNKCCGYV
d) GOS 28
Longueur : 255 acides aminés
Point isoélectrique : 7.74
Poids moléculaire : 29553.18

Clones :

Tsukuba : FC-BE19 ; VFC168
Baylor : IICBP1D39489

Homologues :
Arabidopsis thaliana : GOS 12
Saccharomyces cerevisiae : pas d'homologue
Homo sapiens : pas d'homologue

Séquence d’acides aminés : no core ; TM ; intron
MTSRWDQQQQQQQQQQQQQQIQQQPLLGNVNNSNVSNLAVNQNNLDSLKKERRRLESYIDSKLNHLSTLNDKVQADDEHIDIEYSKIDLSDLSSELDSAFKNVLCNDMLVDDPNFSTNKVHKDKLDDYLNEYRRLKKNIKSTLESFELLEGSTYNKNKDTEIPMTSLLREHSTLQSSSYVQDSILGQARQAHEALENQRRILRGTSHKINTMPSLFQTIDGVTSKIKRYKQRNVVVLGLLIGGLICFLFYYSLKK

Séquence nucléique des introns :
L : gtataacttttaaatacctatacctgtattttatttaataacaattactaataccacc accaccaccaccaccaccactaccatcaccactaccactaccactaccaataacaacaacaatgtgataaagttacaaag
e) MEMBRIN
Longueur : 144 acides aminés
Point isoélectrique : 9.92
Poids moléculaire : 16693.58

Clones :

Jena : JAX4a24a01
Baylor : IIBBP1D5610 ; IIBFP1D1110

Homologues :
Arabidopsis thaliana : MEMB 11 ; MEMB 12
Saccharomyces cerevisiae : pas d'homologue
Homo sapiens : GOSR 2 ; GS 27

Séquence d’acides aminés : core : 67 aa ; TM ; intron
MENKVKQLVEESKSLRKSLDMFLQTKYKKQMEEEEKNKLMGRRKAGESSAIGNLMKENKHLNDGNSTLDSLTEMGNSIIYNLVGQNSKLKGVNKKIYDIANTLGLSRSVIQRIKRRQHQDKVIVYSGMVIVLIIVFLLWYIFRK

Séquence nucléique des introns :
KG : gtaattattattattatattttttttaaaaaaatcaattattttggaaattaatagt aataataataataataataataaccattttttaatttttatattataatttatag

Conclusion :
Tous les processus de fusion membranaire dans les cellules eucaryotes impliquent une machinerie très conservée au plan évolutif qui met en jeu des protéines SNAREs (Soluble NSF Attachment protein Receptors). Les SNAREs jouent un double rôle : d’une part, elles assurent la reconnaissance des compartiments pour garantir la sélectivité des fusions et, d’autre part, elles catalysent l’acte de fusion proprement dit en rapprochant physiquement les membranes concernées.
Au cours de mon stage, j’ai pu identifier par une approche bioinformatique l’ensemble des SNAREs d’un organisme modèle, l’amibe Dictyostelium discoideum, utilisé pour les recherches biomédicales (cf. NIH) et qui se prête à des approches combinées de biochimie génétique, biologie cellulaire et moléculaire.

Le génome de Dictyostelium possède de vingt-cinq gènes codant potentiellement pour des protéines homologues des SNAREs de plantes, levures ou mammifères. La majorité (≥80%) de ces gènes sont exprimés, comme le montre la présence d’ESTs dans les banques d’ADNc de Dictyostelium.

Ainsi, Dictyostelium possède un nombre de SNAREs légèrement supérieure à la levure, mais nettement inférieur aux plantes et à l’homme. Ces SNAREs sont réparties en deux grandes familles : la famille des t-SNAREs ou Q-SNAREs comprenant seize protéines, et la famille des v-SNAREs ou R-SNAREs comprenant neuf protéines.
Les résultats obtenus au cours de mon stage donnent une base solide pour aborder les études biochimiques et cellulaires des diverses SNAREs de Dictyostelium. Ils permettent une analyse comparative avec les SNAREs des autres organismes, dont l’homme, en particulier pour l’identification des divers complexes de SNAREs impliqués dans les fusions membranaires à une localisation donnée et lors de la différenciation cellulaire.

Bibliographie :
1. Sollner T, Whiteheart SW, Brunner M, Erdjument-Bromage H, Geromanos S, Tempst P, Rothman JE. (1993). SNAP receptors implicated in vesicle targeting and fusion. Nature 362, 318-324.
2. Morgan A. (1995). Exocytosis. Essays Biochem 30, 77-95.
3. Terrian DM, White MK. (1997). Phylogenetic analysis of membrane trafficking proteins: a family reunion and secondary structure predictions. Eur J Cell Biol 73, 198-204.
4. Linial M. (1997). SNARE proteins--why so many, why so few? J Neurochem 69, 1781-1792.
5. Nichols BJ, Pelham HR. (1998). SNAREs and membrane fusion in the Golgi apparatus. Biochim Biophys Acta 1404, 9-31.
6. Gerst JE. (1999). SNAREs and SNARE regulators in membrane fusion and exocytosis. Cell Mol Life Sci 55, 707-734.

7. Parlati F, Weber T, McNew JA, Westermann B, Sollner TH, Rothman JE. (1999). Rapid and efficient fusion of phospholipid vesicles by the alpha-helical core of a SNARE complex in the absence of an N-terminal regulatory domain. Proc Natl Acad Sci USA 96, 12565-12570.
8. Bogdanovic A, Bruckert F, Morio T, Satre M. (2000). A Syntaxin 7 Homologue Is Present in Dictyostelium discoideum Endosomes and Controls Their Homotypic Fusion. J. Biol. Chem 275, 36691-36697.
9. McNew JA, Weber T, Parlati F, Johnston RJ, Melia TJ, Sollner TH, Rothman JE. (2000). Close is not enough: SNARE-dependent membrane fusion requires an active mechanism that transduces force to membrane anchors. J Cell Biol 150, 105-117.
10. Parlati F, McNew JA, Fukuda R, Miller R, Sollner TH, Rothman JE. (2000). Topological restriction of SNARE-dependent membrane fusion. Nature 407, 144-146.
11. Weidenhaupt M, Bruckert F, Louwagie M, Garin J, Satre M. (2000). Functional and molecular identification of novel members of the ubiquitous membrane fusion proteins alpha- and gamma-SNAP (soluble N-ethylmaleimide-sensitive factor-attachment proteins) families in Dictyostelium discoideum. Eur J Biochem 267, 2062-2070.
12. Teng FY, Wang Y, Tang BL. (2001). The syntaxins. Genome Biol 2, REVIEWS 3012.
13. Hepp R, Langley K. (2001). SNAREs during development. Cell Tissue Res 305, 247-253.
14. Glockner G, Eichinger L, Szafranski K, Pachebat JA, Bankier AT, Dear PH, Lehmann R, Baumgart C, Parra G, Abril JF, Guigo R, Kumpf K, Tunggal B, Cox E, Quail MA, Platzer M, Rosenthal A, Noegel AA; Dictyostelium Genome Sequencing Consortium. (2002). Sequence and analysis of chromosome 2 of Dictyostelium discoideum. Nature 418, 79-85.
15. Kreppel L, Kimmel AR. (2002). Genomic database resources for Dictyostelium discoideum. Nucleic Acids Res 30, 84-86.
16. Beraud-Dufour S, Balch W. (2002). A journey through the exocytic pathway. J Cell Sci 115, 1779-1780.
17. Gupta GD, Brent Heath I. (2002). Predicting the distribution, conservation, and functions of SNAREs and related proteins in fungi. Fungal Genet Biol 36, 1-21.
18. Parlati F, Varlamov O, Paz K, McNew JA, Hurtado D, Sollner TH, Rothman JE. (2002). Distinct SNARE complexes mediating membrane fusion in Golgi transport based on combinatorial specificity. Proc Natl Acad Sci USA 99, 5424-5429.




Maître de stage : Michel SATRE

Laboratoire de Biochimie et Biophysique des Systèmes Intégrés

UMR 5092, CNRS-CEA-UJF

Département Réponse et Dynamique Cellulaires

CEA-GRENOBLE

1   2   3   4   5   6   7   8

similaire:

Rapport de stage technicien iconRapport de stage

Rapport de stage technicien iconRapport de stage

Rapport de stage technicien iconRapport de stage

Rapport de stage technicien iconRapport de stage Licence 3

Rapport de stage technicien iconRapport de stage esthetique sommaire

Rapport de stage technicien iconDécouvrir l’envers du décor d’un tournage et son processus de fabrication...
«spécial coupe du monde», Roller, Techniques artistiques, Tennis, Vélo-Evolution, Vélo-Mômes, Stage x-trem, Stage "Aventure" pour...

Rapport de stage technicien iconDécouvrir l’envers du décor d’un tournage et son processus de fabrication...
«spécial coupe du monde», Roller, Techniques artistiques, Tennis, Vélo-Evolution, Vélo-Mômes, Stage x-trem, Stage "Aventure" pour...

Rapport de stage technicien iconDécouvrir l’envers du décor d’un tournage et son processus de fabrication...
«spécial coupe du monde», Roller, Techniques artistiques, Tennis, Vélo-Evolution, Vélo-Mômes, Stage x-trem, Stage "Aventure" pour...

Rapport de stage technicien iconRapport de stage
«Sans projet, sans visée à atteindre, la maintenance s’enfonce dans une routine dans des habitudes, dans des acquis difficiles à...

Rapport de stage technicien iconPour les jeunes qui veulent bouger, pour les parents souhaitant trouver...
«spécial coupe du monde», Roller, Techniques artistiques, Tennis, Vélo-Evolution, Vélo-Mômes, Stage x-trem, Stage "Aventure" pour...








Tous droits réservés. Copyright © 2016
contacts
b.21-bal.com